vial
KPV
Alpha-MSH tripeptide fragment studied for gut and dermal inflammation.
- Total mass
- 10mg
- Purity
- ≥99%
- Price per mg
- $7.50/mg
$75.00
Save 10% At 5+vialImmune Signaling Research
LL-37
- Total mass
- 5mg
- Purity
- ≥99% purity
- Presentation
- lyophilized
- Price per mg
- $19.00/mg
$95.00
most popular
best value
- Free Shipping Over $200
- Damage Protection
- Ships today if ordered by 2pm EST
visa · mastercard · amex · discover
About This Compound
LL-37 is the only human cathelicidin-derived antimicrobial peptide, a 37-residue fragment cleaved from hCAP18. Research treats it as a dual-function molecule: a direct membrane-active antimicrobial and a host-defence signaling peptide that recruits and modulates immune cells.
A 37-residue cationic, amphipathic alpha-helical peptide released by proteolytic cleavage from the C-terminus of the 18-kDa human cathelicidin protein hCAP-18. It is the only cathelicidin-derived antimicrobial peptide found in humans and is expressed by neutrophils and epithelial cells. The name comes from its two N-terminal leucines and its length (37 residues).
- Host-Defense Peptide
- Immune / Wound Research
Molecular Profile
| Specification | Value |
|---|---|
| Type | Cationic host-defense (antimicrobial) peptide |
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | ~4,493 g/mol |
| Amino Acids | 37 |
| Sequence | [LL-37, 37 aa] |
| Parent Protein | hCAP-18 (human cathelicidin, CAMP gene) |
Quality & Testing
01
Identity
mass spec
02
Purity
HPLC ≥99%
03
Quantity
net peptide content
04
Endotoxin
LAL assay
05
Heavy Metals
ICP-MS
Shipping & Returns
Orders placed before 2pm EST on a business day leave the same day.
All orders over $200 ship free. Standard ground is $15 and arrives in 3 to 7 days. Expedited is $25 and arrives in 1 to 3 days. Your cart shows exactly how far you are from the free threshold.
Protective packaging on every order, and nothing on the outer box identifies the contents.
Shipment protection is included at no cost. Lost, damaged, or stolen packages are reshipped with no claim form and no deductible.
All sprays are final sale. Unopened vials and capsules can be returned if unused within 14 days of delivery.
Pairs Well With
- vial
THYMOSIN ALPHA-1
Thymic peptide studied for T-cell maturation and immune modulation.
- Total mass
- 10mg
- Purity
- ≥99%
- Price per mg
- $10.50/mg
$105.00
Save 10% At 5+ - supply
Research use only. LL-37 is sold strictly for laboratory research. It is not a drug, food, cosmetic, or medical device, and is not for human or veterinary consumption. These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease. Purchasers confirm they are qualified researchers aged 21 or older and accept responsibility for safe handling and lawful use.